| Class b: All beta proteins [48724] (165 folds) |
| Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) ![]() |
| Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
| Protein Human immunodeficiency virus type 1 protease [50632] (1 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (230 PDB entries) |
| Domain d2aoia1: 2aoi A:1-99 [127092] automatically matched to d1fgcc_ complexed with frd, nh2, so4; mutant |
PDB Entry: 2aoi (more details), 1.4 Å
SCOP Domain Sequences for d2aoia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aoia1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
Timeline for d2aoia1: