SCOPe 2.02: Domain d2aogb_: 2aog B:

Lineage for d2aogb_ (2aog B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (7 species)

7. Species Human immunodeficiency virus type 1 (bh5 isolate) [TaxId:11682] [186950] (13 PDB entries)

8. Domain d2aogb_: 2aog B: [127089]
   automated match to d1s65a_
   complexed with 2nc, acy, gol, unx; mutant

Details for d2aogb_

PDB Entry: 2aog, 1.1 Å

PDB Description: crystal structure analysis of hiv-1 protease mutant v82a with a substrate analog p2-nc

PDB Compounds: (B:) hiv-1 protease (retropepsin)

SCOPe Domain Sequences for d2aogb_:

Sequence; same for both SEQRES and ATOM records:

>d2aogb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bh5 isolate) [TaxId: 11682]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf

Timeline for d2aogb_:

• d2aogb_ first appeared in SCOP 1.73, called d2aogb1
  
• d2aogb_ appears in SCOPe 2.01
  
• d2aogb_ appears in SCOPe 2.03
  
• d2aogb_ appears in the current release, SCOPe 2.08