Lineage for d2aoga_ (2aog A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2408657Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2408673Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2408852Species Human immunodeficiency virus type 1 (bh5 isolate) [TaxId:11682] [186950] (7 PDB entries)
  8. 2408855Domain d2aoga_: 2aog A: [127088]
    automated match to d1s65a_
    complexed with 2nc, acy, gol, unx; mutant

Details for d2aoga_

PDB Entry: 2aog (more details), 1.1 Å

PDB Description: crystal structure analysis of hiv-1 protease mutant v82a with a substrate analog p2-nc
PDB Compounds: (A:) hiv-1 protease (retropepsin)

SCOPe Domain Sequences for d2aoga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aoga_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bh5 isolate) [TaxId: 11682]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf

SCOPe Domain Coordinates for d2aoga_:

Click to download the PDB-style file with coordinates for d2aoga_.
(The format of our PDB-style files is described here.)

Timeline for d2aoga_: