![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
![]() | Species Human immunodeficiency virus type 1 (bh5 isolate) [TaxId:11682] [186950] (7 PDB entries) |
![]() | Domain d2aoga_: 2aog A: [127088] automated match to d1s65a_ complexed with 2nc, acy, gol, unx; mutant |
PDB Entry: 2aog (more details), 1.1 Å
SCOPe Domain Sequences for d2aoga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aoga_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bh5 isolate) [TaxId: 11682]} pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
Timeline for d2aoga_: