Lineage for d2aoea_ (2aoe A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320913Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1320914Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1320915Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1320931Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. 1321064Species Human immunodeficiency virus type 1 (bh5 isolate) [TaxId:11682] [186950] (7 PDB entries)
  8. 1321075Domain d2aoea_: 2aoe A: [127084]
    automated match to d1s65a_
    complexed with 0q4, acy, cl, dms, gol, na; mutant

Details for d2aoea_

PDB Entry: 2aoe (more details), 1.54 Å

PDB Description: crystal structure analysis of hiv-1 protease mutant v82a with a substrate analog ca-p2
PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d2aoea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aoea_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bh5 isolate) [TaxId: 11682]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf

SCOPe Domain Coordinates for d2aoea_:

Click to download the PDB-style file with coordinates for d2aoea_.
(The format of our PDB-style files is described here.)

Timeline for d2aoea_: