SCOPe 2.03: Domain d2aoda_: 2aod A:

Lineage for d2aoda_ (2aod A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 (bh5 isolate) [TaxId:11682] [186950] (7 PDB entries)

8. Domain d2aoda_: 2aod A: [127082]
   automated match to d1fgcc_
   complexed with 2nc, dms, gol, unx

Details for d2aoda_

PDB Entry: 2aod, 1.4 Å

PDB Description: crystal structure analysis of hiv-1 protease with a substrate analog p2-nc

PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d2aoda_:

Sequence; same for both SEQRES and ATOM records:

>d2aoda_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bh5 isolate) [TaxId: 11682]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d2aoda_:

• d2aoda_ first appeared in SCOP 1.73, called d2aoda1
  
• d2aoda_ appears in SCOPe 2.02
  
• d2aoda_ appears in SCOPe 2.04
  
• d2aoda_ appears in the current release, SCOPe 2.08