SCOP 1.73: Domain d2aoda1: 2aod A:1-99

Lineage for d2aoda1 (2aod A:1-99)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (230 PDB entries)

8. Domain d2aoda1: 2aod A:1-99 [127082]
   automatically matched to d1fgcc_
   complexed with 2ao, ace, dms, gol, nh2, olt; mutant

Details for d2aoda1

PDB Entry: 2aod, 1.4 Å

PDB Description: crystal structure analysis of hiv-1 protease with a substrate analog p2-nc

PDB Compounds: (A:) Pol polyprotein

SCOP Domain Sequences for d2aoda1:

Sequence; same for both SEQRES and ATOM records:

>d2aoda1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d2aoda1:

• d2aoda1 is new in SCOP 1.73
  
• d2aoda1 appears in SCOP 1.75
  
• d2aoda1 appears in the current release, SCOPe 2.08, called d2aoda_