Class b: All beta proteins [48724] (174 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (7 species) |
Species Human immunodeficiency virus type 1 (bh5 isolate) [TaxId:11682] [186950] (13 PDB entries) |
Domain d2aoca_: 2aoc A: [127080] automated match to d1s6sa_ complexed with 2nc, cl, dms, gol, na, unx; mutant |
PDB Entry: 2aoc (more details), 1.3 Å
SCOPe Domain Sequences for d2aoca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aoca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bh5 isolate) [TaxId: 11682]} pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf
Timeline for d2aoca_: