SCOP 1.73: Domain d2aoba1: 2aob A:60-151

Lineage for d2aoba1 (2aob A:60-151)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (32 proteins)
   Pfam PF00017

6. Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55564] (20 PDB entries)

8. Domain d2aoba1: 2aob A:60-151 [127076]
   automatically matched to d1fhs__
   complexed with s1s

Details for d2aoba1

PDB Entry: 2aob, 1.8 Å

PDB Description: crystal structures of a high-affinity macrocyclic peptide mimetic in complex with the grb2 sh2 domain

PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOP Domain Sequences for d2aoba1:

Sequence; same for both SEQRES and ATOM records:

>d2aoba1 d.93.1.1 (A:60-151) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
wffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagkyf
lwvvkfnslnelvdyhrstsvsrnqqiflrdi

Timeline for d2aoba1:

• d2aoba1 is new in SCOP 1.73
  
• d2aoba1 appears in SCOP 1.75
  
• d2aoba1 appears in the current release, SCOPe 2.08, called d2aoba_