SCOP 1.75: Domain d2ao9h1: 2ao9 H:15-130

Lineage for d2ao9h1 (2ao9 H:15-130)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (19 families)
   consists only of helices

5. Family a.4.1.17: Nanomeric phage protein-like [140219] (1 protein)
   contains additional N and C-terminal helices and the C-terminal beta-strand forming an intersubunit beta-barrel with a channel

6. Protein Phage protein BC1890 [140220] (1 species)

7. Species Bacillus cereus [TaxId:1396] [140221] (1 PDB entry)
   Uniprot Q81ES4 13-132
   host bacterium

8. Domain d2ao9h1: 2ao9 H:15-130 [127074]
   automatically matched to 2AO9 A:13-132

Details for d2ao9h1

PDB Entry: 2ao9, 1.9 Å

PDB Description: Structural Genomics, The crystal structure of a Phage protein (phBC6A51) from Bacillus cereus ATCC 14579

PDB Compounds: (H:) Phage protein

SCOP Domain Sequences for d2ao9h1:

Sequence, based on SEQRES records:

>d2ao9h1 a.4.1.17 (H:15-130) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}
akldelkqkltakqiqaayllvenelmesnneekrtqdemanelginrttlwewrtknqd
fiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkvieg

Sequence, based on observed residues (ATOM records):

>d2ao9h1 a.4.1.17 (H:15-130) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}
akldelkqkltakqiqaayllvenelmeseekrtqdemanelginrttlwewrtknqdfi
afksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkvieg

Timeline for d2ao9h1:

• d2ao9h1 first appeared in SCOP 1.73
  
• d2ao9h1 appears in SCOPe 2.01
  
• d2ao9h1 appears in the current release, SCOPe 2.08, called d2ao9h_