Lineage for d2ao9h_ (2ao9 H:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. Family a.4.1.17: Nanomeric phage protein-like [140219] (1 protein)
    contains additional N and C-terminal helices and the C-terminal beta-strand forming an intersubunit beta-barrel with a channel
    automatically mapped to Pfam PF13022
  6. Protein Phage protein BC1890 [140220] (1 species)
  7. Species Bacillus cereus [TaxId:1396] [140221] (1 PDB entry)
    Uniprot Q81ES4 13-132
    host bacterium
  8. Domain d2ao9h_: 2ao9 H: [127074]
    automated match to d2ao9a1

Details for d2ao9h_

PDB Entry: 2ao9 (more details), 1.9 Å

PDB Description: Structural Genomics, The crystal structure of a Phage protein (phBC6A51) from Bacillus cereus ATCC 14579
PDB Compounds: (H:) Phage protein

SCOPe Domain Sequences for d2ao9h_:

Sequence, based on SEQRES records: (download)

>d2ao9h_ a.4.1.17 (H:) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}
akldelkqkltakqiqaayllvenelmesnneekrtqdemanelginrttlwewrtknqd
fiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkvieg

Sequence, based on observed residues (ATOM records): (download)

>d2ao9h_ a.4.1.17 (H:) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}
akldelkqkltakqiqaayllvenelmeseekrtqdemanelginrttlwewrtknqdfi
afksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkvieg

SCOPe Domain Coordinates for d2ao9h_ are not available.

Timeline for d2ao9h_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ao9a1, d2ao9b_, d2ao9c_, d2ao9d_, d2ao9e_, d2ao9f_, d2ao9g_, d2ao9i_