![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.17: Nanomeric phage protein-like [140219] (1 protein) contains additional N and C-terminal helices and the C-terminal beta-strand forming an intersubunit beta-barrel with a channel automatically mapped to Pfam PF13022 |
![]() | Protein Phage protein BC1890 [140220] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [140221] (1 PDB entry) Uniprot Q81ES4 13-132 host bacterium |
![]() | Domain d2ao9f_: 2ao9 F: [127073] automated match to d2ao9a1 |
PDB Entry: 2ao9 (more details), 1.9 Å
SCOPe Domain Sequences for d2ao9f_:
Sequence, based on SEQRES records: (download)
>d2ao9f_ a.4.1.17 (F:) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]} kldelkqkltakqiqaayllvenelmesnneekrtqdemanelginrttlwewrtknqdf iafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegd
>d2ao9f_ a.4.1.17 (F:) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]} kldelkqkltakqiqaayllvenelmkrtqdemanelginrttlwewrtknqdfiafkse vadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegd
Timeline for d2ao9f_: