SCOPe 2.04: Domain d2ao9f_: 2ao9 F:

Lineage for d2ao9f_ (2ao9 F:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.17: Nanomeric phage protein-like [140219] (1 protein)
   contains additional N and C-terminal helices and the C-terminal beta-strand forming an intersubunit beta-barrel with a channel
   automatically mapped to Pfam PF13022

6. Protein Phage protein BC1890 [140220] (1 species)

7. Species Bacillus cereus [TaxId:1396] [140221] (1 PDB entry)
   Uniprot Q81ES4 13-132
   host bacterium

8. Domain d2ao9f_: 2ao9 F: [127073]
   automated match to d2ao9a1

Details for d2ao9f_

PDB Entry: 2ao9, 1.9 Å

PDB Description: Structural Genomics, The crystal structure of a Phage protein (phBC6A51) from Bacillus cereus ATCC 14579

PDB Compounds: (F:) Phage protein

SCOPe Domain Sequences for d2ao9f_:

Sequence, based on SEQRES records:

>d2ao9f_ a.4.1.17 (F:) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}
kldelkqkltakqiqaayllvenelmesnneekrtqdemanelginrttlwewrtknqdf
iafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegd

Sequence, based on observed residues (ATOM records):

>d2ao9f_ a.4.1.17 (F:) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}
kldelkqkltakqiqaayllvenelmkrtqdemanelginrttlwewrtknqdfiafkse
vadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegd

Timeline for d2ao9f_:

• d2ao9f_ first appeared in SCOP 1.73, called d2ao9f1
  
• d2ao9f_ appears in SCOPe 2.03
  
• d2ao9f_ appears in SCOPe 2.05
  
• d2ao9f_ appears in the current release, SCOPe 2.08