SCOPe 2.03: Domain d2ao9e_: 2ao9 E:

Lineage for d2ao9e_ (2ao9 E:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.17: Nanomeric phage protein-like [140219] (1 protein)
   contains additional N and C-terminal helices and the C-terminal beta-strand forming an intersubunit beta-barrel with a channel
   automatically mapped to Pfam PF13022

6. Protein Phage protein BC1890 [140220] (1 species)

7. Species Bacillus cereus [TaxId:1396] [140221] (1 PDB entry)
   Uniprot Q81ES4 13-132
   host bacterium

8. Domain d2ao9e_: 2ao9 E: [127072]
   automated match to d2ao9a1

Details for d2ao9e_

PDB Entry: 2ao9, 1.9 Å

PDB Description: Structural Genomics, The crystal structure of a Phage protein (phBC6A51) from Bacillus cereus ATCC 14579

PDB Compounds: (E:) Phage protein

SCOPe Domain Sequences for d2ao9e_:

Sequence, based on SEQRES records:

>d2ao9e_ a.4.1.17 (E:) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}
makldelkqkltakqiqaayllvenelmesnneekrtqdemanelginrttlwewrtknq
dfiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegdl

Sequence, based on observed residues (ATOM records):

>d2ao9e_ a.4.1.17 (E:) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}
makldelkqkltakqiqaayllvenelmeekrtqdemanelginrttlwewrtknqdfia
fksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegdl

Timeline for d2ao9e_:

• d2ao9e_ first appeared in SCOP 1.73, called d2ao9e1
  
• d2ao9e_ was called d2ao9e1 in SCOPe 2.02
  
• d2ao9e_ appears in SCOPe 2.04
  
• d2ao9e_ appears in the current release, SCOPe 2.08