SCOP 1.73: Domain d2ao9b1: 2ao9 B:14-131

Lineage for d2ao9b1 (2ao9 B:14-131)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (17 families)
   consists only of helices

5. Family a.4.1.17: Nanomeric phage protein-like [140219] (1 protein)
   contains additional N and C-terminal helices and the C-terminal beta-strand forming an intersubunit beta-barrel with a channel

6. Protein Phage protein BC1890 [140220] (1 species)

7. Species Bacillus cereus [TaxId:1396] [140221] (1 PDB entry)
   host bacterium

8. Domain d2ao9b1: 2ao9 B:14-131 [127070]
   automatically matched to 2AO9 A:13-132

Details for d2ao9b1

PDB Entry: 2ao9, 1.9 Å

PDB Description: Structural Genomics, The crystal structure of a Phage protein (phBC6A51) from Bacillus cereus ATCC 14579

PDB Compounds: (B:) Phage protein

SCOP Domain Sequences for d2ao9b1:

Sequence, based on SEQRES records:

>d2ao9b1 a.4.1.17 (B:14-131) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}
makldelkqkltakqiqaayllvenelmesnneekrtqdemanelginrttlwewrtknq
dfiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegd

Sequence, based on observed residues (ATOM records):

>d2ao9b1 a.4.1.17 (B:14-131) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}
makldelkqkltakqiqaayllvenelmeekrtqdemanelginrttlwewrtknqdfia
fksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegd

Timeline for d2ao9b1:

• d2ao9b1 is new in SCOP 1.73
  
• d2ao9b1 appears in SCOP 1.75
  
• d2ao9b1 appears in the current release, SCOPe 2.08, called d2ao9b_