Lineage for d2ao9a1 (2ao9 A:13-132)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634862Family a.4.1.17: Nanomeric phage protein-like [140219] (1 protein)
    contains additional N and C-terminal helices and the C-terminal beta-strand forming an intersubunit beta-barrel with a channel
  6. 634863Protein Phage protein BC1890 [140220] (1 species)
  7. 634864Species Bacillus cereus [TaxId:1396] [140221] (1 PDB entry)
    host bacterium
  8. 634865Domain d2ao9a1: 2ao9 A:13-132 [127069]

Details for d2ao9a1

PDB Entry: 2ao9 (more details), 1.9 Å

PDB Description: Structural Genomics, The crystal structure of a Phage protein (phBC6A51) from Bacillus cereus ATCC 14579
PDB Compounds: (A:) Phage protein

SCOP Domain Sequences for d2ao9a1:

Sequence, based on SEQRES records: (download)

>d2ao9a1 a.4.1.17 (A:13-132) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}
mmakldelkqkltakqiqaayllvenelmesnneekrtqdemanelginrttlwewrtkn
qdfiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegdl

Sequence, based on observed residues (ATOM records): (download)

>d2ao9a1 a.4.1.17 (A:13-132) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}
mmakldelkqkltakqiqaayllvenelmeeekrtqdemanelginrttlwewrtknqdf
iafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegdl

SCOP Domain Coordinates for d2ao9a1:

Click to download the PDB-style file with coordinates for d2ao9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ao9a1: