Lineage for d2ao6a_ (2ao6 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008479Protein Androgen receptor [63621] (4 species)
  7. 2008489Species Human (Homo sapiens) [TaxId:9606] [63623] (62 PDB entries)
    Uniprot P10275 671-919
  8. 2008510Domain d2ao6a_: 2ao6 A: [127068]
    automated match to d1xowa_
    complexed with r18

Details for d2ao6a_

PDB Entry: 2ao6 (more details), 1.89 Å

PDB Description: crystal structure of the human androgen receptor ligand binding domain bound with tif2(iii) 740-753 peptide and r1881
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d2ao6a_:

Sequence, based on SEQRES records: (download)

>d2ao6a_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
vkpiyfht

Sequence, based on observed residues (ATOM records): (download)

>d2ao6a_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiatscsrrf
yqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiyf
ht

SCOPe Domain Coordinates for d2ao6a_:

Click to download the PDB-style file with coordinates for d2ao6a_.
(The format of our PDB-style files is described here.)

Timeline for d2ao6a_: