Lineage for d2ao2c_ (2ao2 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345538Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2345539Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2345590Family a.130.1.4: Secreted chorismate mutase-like [140945] (1 protein)
    duplication; two structural repeats, like in the yeast enzyme, but with a different location of the remaining active site
  6. 2345591Protein Secreted chorismate mutase [140946] (1 species)
  7. 2345592Species Mycobacterium tuberculosis [TaxId:1773] [140947] (4 PDB entries)
    Uniprot O07746 34-199
  8. 2345599Domain d2ao2c_: 2ao2 C: [127067]
    automated match to d2ao2a1
    complexed with so4, trp

Details for d2ao2c_

PDB Entry: 2ao2 (more details), 2.07 Å

PDB Description: The 2.07 Angstrom crystal structure of Mycobacterium tuberculosis chorismate mutase reveals unexpected gene duplication and suggests a role in host-pathogen interactions
PDB Compounds: (C:) chorismate mutase

SCOPe Domain Sequences for d2ao2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ao2c_ a.130.1.4 (C:) Secreted chorismate mutase {Mycobacterium tuberculosis [TaxId: 1773]}
gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv
trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl
lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa

SCOPe Domain Coordinates for d2ao2c_:

Click to download the PDB-style file with coordinates for d2ao2c_.
(The format of our PDB-style files is described here.)

Timeline for d2ao2c_: