Lineage for d2ao2b1 (2ao2 B:35-199)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648923Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 648924Superfamily a.130.1: Chorismate mutase II [48600] (4 families) (S)
  5. 648960Family a.130.1.4: Secreted chorismate mutase-like [140945] (1 protein)
    duplication; two structural repeats, like in the yeast enzyme, but with a different location of the remaining active site
  6. 648961Protein Secreted chorismate mutase [140946] (1 species)
  7. 648962Species Mycobacterium tuberculosis [TaxId:1773] [140947] (4 PDB entries)
  8. 648970Domain d2ao2b1: 2ao2 B:35-199 [127066]
    automatically matched to 2F6L A:34-199
    complexed with so4, trp

Details for d2ao2b1

PDB Entry: 2ao2 (more details), 2.07 Å

PDB Description: The 2.07 Angstrom crystal structure of Mycobacterium tuberculosis chorismate mutase reveals unexpected gene duplication and suggests a role in host-pathogen interactions
PDB Compounds: (B:) chorismate mutase

SCOP Domain Sequences for d2ao2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ao2b1 a.130.1.4 (B:35-199) Secreted chorismate mutase {Mycobacterium tuberculosis [TaxId: 1773]}
gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv
trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl
lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa

SCOP Domain Coordinates for d2ao2b1:

Click to download the PDB-style file with coordinates for d2ao2b1.
(The format of our PDB-style files is described here.)

Timeline for d2ao2b1: