Class a: All alpha proteins [46456] (258 folds) |
Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (4 families) |
Family a.130.1.4: Secreted chorismate mutase-like [140945] (1 protein) duplication; two structural repeats, like in the yeast enzyme, but with a different location of the remaining active site |
Protein Secreted chorismate mutase [140946] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [140947] (4 PDB entries) |
Domain d2ao2b1: 2ao2 B:35-199 [127066] automatically matched to 2F6L A:34-199 complexed with so4, trp |
PDB Entry: 2ao2 (more details), 2.07 Å
SCOP Domain Sequences for d2ao2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ao2b1 a.130.1.4 (B:35-199) Secreted chorismate mutase {Mycobacterium tuberculosis [TaxId: 1773]} gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa
Timeline for d2ao2b1: