SCOPe 2.07: Domain d2ao2a_: 2ao2 A:

Lineage for d2ao2a_ (2ao2 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families)

5. Family a.130.1.4: Secreted chorismate mutase-like [140945] (1 protein)
   duplication; two structural repeats, like in the yeast enzyme, but with a different location of the remaining active site

6. Protein Secreted chorismate mutase [140946] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140947] (4 PDB entries)
   Uniprot O07746 34-199

8. Domain d2ao2a_: 2ao2 A: [127065]
   automated match to d2ao2a1
   complexed with so4, trp

Details for d2ao2a_

PDB Entry: 2ao2, 2.07 Å

PDB Description: The 2.07 Angstrom crystal structure of Mycobacterium tuberculosis chorismate mutase reveals unexpected gene duplication and suggests a role in host-pathogen interactions

PDB Compounds: (A:) chorismate mutase

SCOPe Domain Sequences for d2ao2a_:

Sequence; same for both SEQRES and ATOM records:

>d2ao2a_ a.130.1.4 (A:) Secreted chorismate mutase {Mycobacterium tuberculosis [TaxId: 1773]}
gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv
trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl
lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa

Timeline for d2ao2a_:

• d2ao2a_ first appeared in SCOP 1.73, called d2ao2a1
  
• d2ao2a_ appears in SCOPe 2.06
  
• d2ao2a_ appears in the current release, SCOPe 2.08