![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
![]() | Superfamily a.130.1: Chorismate mutase II [48600] (4 families) ![]() |
![]() | Family a.130.1.4: Secreted chorismate mutase-like [140945] (1 protein) duplication; two structural repeats, like in the yeast enzyme, but with a different location of the remaining active site |
![]() | Protein Secreted chorismate mutase [140946] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [140947] (4 PDB entries) Uniprot O07746 34-199 |
![]() | Domain d2ao2a_: 2ao2 A: [127065] automated match to d2ao2a1 complexed with so4, trp |
PDB Entry: 2ao2 (more details), 2.07 Å
SCOPe Domain Sequences for d2ao2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ao2a_ a.130.1.4 (A:) Secreted chorismate mutase {Mycobacterium tuberculosis [TaxId: 1773]} gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa
Timeline for d2ao2a_: