Lineage for d2ao2a_ (2ao2 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098826Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 1098827Superfamily a.130.1: Chorismate mutase II [48600] (4 families) (S)
  5. 1098875Family a.130.1.4: Secreted chorismate mutase-like [140945] (1 protein)
    duplication; two structural repeats, like in the yeast enzyme, but with a different location of the remaining active site
  6. 1098876Protein Secreted chorismate mutase [140946] (1 species)
  7. 1098877Species Mycobacterium tuberculosis [TaxId:1773] [140947] (4 PDB entries)
    Uniprot O07746 34-199
  8. 1098884Domain d2ao2a_: 2ao2 A: [127065]
    automated match to d2ao2a1
    complexed with so4, trp

Details for d2ao2a_

PDB Entry: 2ao2 (more details), 2.07 Å

PDB Description: The 2.07 Angstrom crystal structure of Mycobacterium tuberculosis chorismate mutase reveals unexpected gene duplication and suggests a role in host-pathogen interactions
PDB Compounds: (A:) chorismate mutase

SCOPe Domain Sequences for d2ao2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ao2a_ a.130.1.4 (A:) Secreted chorismate mutase {Mycobacterium tuberculosis [TaxId: 1773]}
gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv
trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl
lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa

SCOPe Domain Coordinates for d2ao2a_:

Click to download the PDB-style file with coordinates for d2ao2a_.
(The format of our PDB-style files is described here.)

Timeline for d2ao2a_: