Lineage for d2anza_ (2anz A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2719985Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2719986Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries)
    Uniprot P00431
  8. 2720049Domain d2anza_: 2anz A: [127064]
    automated match to d1aa4__
    complexed with 26d, hem

Details for d2anza_

PDB Entry: 2anz (more details), 1.75 Å

PDB Description: cytochrome c peroxidase in complex with 2,6-diaminopyridine
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d2anza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2anza_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d2anza_:

Click to download the PDB-style file with coordinates for d2anza_.
(The format of our PDB-style files is described here.)

Timeline for d2anza_: