Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
Superfamily c.6.3: PHP domain-like [89550] (3 families) |
Family c.6.3.1: PHP domain [89551] (2 proteins) putative phosphoesterase domain; contains trinuclear metal-binding site; some similarity to the metallohydrolases of TIM-barrel fold |
Protein Hypothetical protein TM0559 [141949] (1 species) |
Species Thermotoga maritima [TaxId:2336] [141950] (1 PDB entry) Uniprot Q9WZ29 5-233 |
Domain d2anue_: 2anu E: [127062] automated match to d2anua1 complexed with cl, zn |
PDB Entry: 2anu (more details), 2.4 Å
SCOPe Domain Sequences for d2anue_:
Sequence, based on SEQRES records: (download)
>d2anue_ c.6.3.1 (E:) Hypothetical protein TM0559 {Thermotoga maritima [TaxId: 2336]} tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee iveklkeqnalviaahpdrkkqdeehlswylwanmerfkdtfdaweianrddlfnsvgvk kyryvansdfhelwhvyswktlvkseknieaikeairkntdvaiylmr
>d2anue_ c.6.3.1 (E:) Hypothetical protein TM0559 {Thermotoga maritima [TaxId: 2336]} tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee iveklkeqnalviaahpdrkhlswylwanmerfkdtfdaweianrddlfnsvgvkkyryv ansdfhelwhvyswktlvkseknieaikeairkntdvaiylmr
Timeline for d2anue_: