Lineage for d2anue_ (2anu E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850756Superfamily c.6.3: PHP domain-like [89550] (3 families) (S)
  5. 2850757Family c.6.3.1: PHP domain [89551] (2 proteins)
    putative phosphoesterase domain; contains trinuclear metal-binding site; some similarity to the metallohydrolases of TIM-barrel fold
  6. 2850758Protein Hypothetical protein TM0559 [141949] (1 species)
  7. 2850759Species Thermotoga maritima [TaxId:2336] [141950] (1 PDB entry)
    Uniprot Q9WZ29 5-233
  8. 2850764Domain d2anue_: 2anu E: [127062]
    automated match to d2anua1
    complexed with cl, zn

Details for d2anue_

PDB Entry: 2anu (more details), 2.4 Å

PDB Description: crystal structure of predicted metal-dependent phosphoesterase (php family) (tm0559) from thermotoga maritima at 2.40 a resolution
PDB Compounds: (E:) hypothetical protein TM0559

SCOPe Domain Sequences for d2anue_:

Sequence, based on SEQRES records: (download)

>d2anue_ c.6.3.1 (E:) Hypothetical protein TM0559 {Thermotoga maritima [TaxId: 2336]}
tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga
itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee
iveklkeqnalviaahpdrkkqdeehlswylwanmerfkdtfdaweianrddlfnsvgvk
kyryvansdfhelwhvyswktlvkseknieaikeairkntdvaiylmr

Sequence, based on observed residues (ATOM records): (download)

>d2anue_ c.6.3.1 (E:) Hypothetical protein TM0559 {Thermotoga maritima [TaxId: 2336]}
tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga
itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee
iveklkeqnalviaahpdrkhlswylwanmerfkdtfdaweianrddlfnsvgvkkyryv
ansdfhelwhvyswktlvkseknieaikeairkntdvaiylmr

SCOPe Domain Coordinates for d2anue_:

Click to download the PDB-style file with coordinates for d2anue_.
(The format of our PDB-style files is described here.)

Timeline for d2anue_: