Lineage for d2anuc1 (2anu C:5-232)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689534Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 689676Superfamily c.6.3: PHP domain-like [89550] (2 families) (S)
  5. 689677Family c.6.3.1: PHP domain [89551] (2 proteins)
    putative phosphoesterase domain; contains trinuclear metal-binding site; some similarity to the metallohydrolases of TIM-barrel fold
  6. 689678Protein Hypothetical protein TM0559 [141949] (1 species)
  7. 689679Species Thermotoga maritima [TaxId:2336] [141950] (1 PDB entry)
  8. 689682Domain d2anuc1: 2anu C:5-232 [127060]
    automatically matched to 2ANU A:5-233
    complexed with cl, zn

Details for d2anuc1

PDB Entry: 2anu (more details), 2.4 Å

PDB Description: crystal structure of predicted metal-dependent phosphoesterase (php family) (tm0559) from thermotoga maritima at 2.40 a resolution
PDB Compounds: (C:) hypothetical protein TM0559

SCOP Domain Sequences for d2anuc1:

Sequence, based on SEQRES records: (download)

>d2anuc1 c.6.3.1 (C:5-232) Hypothetical protein TM0559 {Thermotoga maritima [TaxId: 2336]}
tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga
itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee
iveklkeqnalviaahpdrkkqdeehlswylwanmerfkdtfdaweianrddlfnsvgvk
kyryvansdfhelwhvyswktlvkseknieaikeairkntdvaiylmr

Sequence, based on observed residues (ATOM records): (download)

>d2anuc1 c.6.3.1 (C:5-232) Hypothetical protein TM0559 {Thermotoga maritima [TaxId: 2336]}
tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga
itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee
iveklkeqnalviaahpdrkkswylwanmerfkdtfdaweianrddlfnsvgvkkyryva
nsdfhelwhvyswktlvkseknieaikeairkntdvaiylmr

SCOP Domain Coordinates for d2anuc1:

Click to download the PDB-style file with coordinates for d2anuc1.
(The format of our PDB-style files is described here.)

Timeline for d2anuc1: