SCOP 1.73: Domain d2anua1: 2anu A:5-233

Lineage for d2anua1 (2anu A:5-233)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.3: PHP domain-like [89550] (2 families)

5. Family c.6.3.1: PHP domain [89551] (2 proteins)
   putative phosphoesterase domain; contains trinuclear metal-binding site; some similarity to the metallohydrolases of TIM-barrel fold

6. Protein Hypothetical protein TM0559 [141949] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [141950] (1 PDB entry)

8. Domain d2anua1: 2anu A:5-233 [127058]
   complexed with cl, zn

Details for d2anua1

PDB Entry: 2anu, 2.4 Å

PDB Description: crystal structure of predicted metal-dependent phosphoesterase (php family) (tm0559) from thermotoga maritima at 2.40 a resolution

PDB Compounds: (A:) hypothetical protein TM0559

SCOP Domain Sequences for d2anua1:

Sequence, based on SEQRES records:

>d2anua1 c.6.3.1 (A:5-233) Hypothetical protein TM0559 {Thermotoga maritima [TaxId: 2336]}
tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga
itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee
iveklkeqnalviaahpdrkkqdeehlswylwanmerfkdtfdaweianrddlfnsvgvk
kyryvansdfhelwhvyswktlvkseknieaikeairkntdvaiylmrk

Sequence, based on observed residues (ATOM records):

>d2anua1 c.6.3.1 (A:5-233) Hypothetical protein TM0559 {Thermotoga maritima [TaxId: 2336]}
tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga
itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee
iveklkeqnalviaahpdrkklswylwanmerfkdtfdaweianrddlfnsvgvkkyryv
ansdfhelwhvyswktlvkseknieaikeairkntdvaiylmrk

Timeline for d2anua1:

• d2anua1 is new in SCOP 1.73
  
• d2anua1 appears in SCOP 1.75
  
• d2anua1 appears in the current release, SCOPe 2.08