SCOPe 2.08: Domain d2anqa_: 2anq A:

Lineage for d2anqa_ (2anq A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)

7. Species Escherichia coli [TaxId:562] [53600] (86 PDB entries)

8. Domain d2anqa_: 2anq A: [127057]
   automated match to d1dre__
   complexed with c1a, mn, ndp

Details for d2anqa_

PDB Entry: 2anq, 2.13 Å

PDB Description: crystal structure of e.coli dhfr in complex with nadph and the inhibitor compound 10a.

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2anqa_:

Sequence; same for both SEQRES and ATOM records:

>d2anqa_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d2anqa_:

• d2anqa_ first appeared in SCOP 1.73, called d2anqa1
  
• d2anqa_ appears in SCOPe 2.07