SCOPe 2.08: Domain d2anja1: 2anj A:3-117,A:120-262

Lineage for d2anja1 (2anj A:3-117,A:120-262)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries)

8. Domain d2anja1: 2anj A:3-117,A:120-262 [127054]
   Other proteins in same PDB: d2anja2
   complexed with kai; mutant

Details for d2anja1

PDB Entry: 2anj, 2.1 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2j-y450w) mutant in complex with the partial agonist kainic acid at 2.1 a resolution

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d2anja1:

Sequence; same for both SEQRES and ATOM records:

>d2anja1 c.94.1.1 (A:3-117,A:120-262) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkwg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkXpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgecg

Timeline for d2anja1:

• d2anja1 first appeared in SCOP 1.73
  
• d2anja1 appears in SCOPe 2.07