Class b: All beta proteins [48724] (180 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (15 families) |
Family b.122.1.10: LON domain-like [141723] (3 proteins) Pfam PF02190 |
Protein ATP-dependent protease La (Lon), N-terminal domain [141724] (1 species) |
Species Escherichia coli [TaxId:562] [141725] (1 PDB entry) Uniprot P0A9M0 8-117 |
Domain d2aneg_: 2ane G: [127052] automated match to d2anea1 |
PDB Entry: 2ane (more details), 2.03 Å
SCOPe Domain Sequences for d2aneg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aneg_ b.122.1.10 (G:) ATP-dependent protease La (Lon), N-terminal domain {Escherichia coli [TaxId: 562]} rieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvnd lftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl
Timeline for d2aneg_: