Lineage for d2aneg_ (2ane G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824048Family b.122.1.10: LON domain-like [141723] (3 proteins)
    Pfam PF02190
  6. 2824049Protein ATP-dependent protease La (Lon), N-terminal domain [141724] (1 species)
  7. 2824050Species Escherichia coli [TaxId:562] [141725] (1 PDB entry)
    Uniprot P0A9M0 8-117
  8. 2824057Domain d2aneg_: 2ane G: [127052]
    automated match to d2anea1

Details for d2aneg_

PDB Entry: 2ane (more details), 2.03 Å

PDB Description: crystal structure of n-terminal domain of e.coli lon protease
PDB Compounds: (G:) ATP-dependent protease La

SCOPe Domain Sequences for d2aneg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aneg_ b.122.1.10 (G:) ATP-dependent protease La (Lon), N-terminal domain {Escherichia coli [TaxId: 562]}
rieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvnd
lftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl

SCOPe Domain Coordinates for d2aneg_:

Click to download the PDB-style file with coordinates for d2aneg_.
(The format of our PDB-style files is described here.)

Timeline for d2aneg_: