SCOPe 2.07: Domain d2aned_: 2ane D:

Lineage for d2aned_ (2ane D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.10: LON domain-like [141723] (3 proteins)
   Pfam PF02190

6. Protein ATP-dependent protease La (Lon), N-terminal domain [141724] (1 species)

7. Species Escherichia coli [TaxId:562] [141725] (1 PDB entry)
   Uniprot P0A9M0 8-117

8. Domain d2aned_: 2ane D: [127049]
   automated match to d2anea1

Details for d2aned_

PDB Entry: 2ane, 2.03 Å

PDB Description: crystal structure of n-terminal domain of e.coli lon protease

PDB Compounds: (D:) ATP-dependent protease La

SCOPe Domain Sequences for d2aned_:

Sequence; same for both SEQRES and ATOM records:

>d2aned_ b.122.1.10 (D:) ATP-dependent protease La (Lon), N-terminal domain {Escherichia coli [TaxId: 562]}
rieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvnd
lftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl

Timeline for d2aned_:

• d2aned_ first appeared in SCOP 1.73, called d2aned1
  
• d2aned_ appears in SCOPe 2.06
  
• d2aned_ appears in the current release, SCOPe 2.08