SCOP 1.73: Domain d2aneb1: 2ane B:10-117

Lineage for d2aneb1 (2ane B:10-117)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (10 families)

5. Family b.122.1.10: LON domain-like [141723] (2 proteins)
   Pfam PF02190

6. Protein ATP-dependent protease La (Lon), N-terminal domain [141724] (1 species)

7. Species Escherichia coli [TaxId:562] [141725] (1 PDB entry)

8. Domain d2aneb1: 2ane B:10-117 [127047]
   automatically matched to 2ANE A:8-117

Details for d2aneb1

PDB Entry: 2ane, 2.03 Å

PDB Description: crystal structure of n-terminal domain of e.coli lon protease

PDB Compounds: (B:) ATP-dependent protease La

SCOP Domain Sequences for d2aneb1:

Sequence; same for both SEQRES and ATOM records:

>d2aneb1 b.122.1.10 (B:10-117) ATP-dependent protease La (Lon), N-terminal domain {Escherichia coli [TaxId: 562]}
eipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvndlf
tvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl

Timeline for d2aneb1:

• d2aneb1 is new in SCOP 1.73
  
• d2aneb1 appears in SCOP 1.75
  
• d2aneb1 appears in the current release, SCOPe 2.08, called d2aneb_