Lineage for d2ancc1 (2anc C:3-206)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123583Protein Guanylate kinase [52542] (5 species)
  7. 2123599Species Escherichia coli [TaxId:562] [102338] (6 PDB entries)
  8. 2123609Domain d2ancc1: 2anc C:3-206 [127042]
    automatically matched to d1s96a_

Details for d2ancc1

PDB Entry: 2anc (more details), 3.2 Å

PDB Description: Crystal Structure Of Unliganded Form Of Oligomeric E.coli Guanylate Kinase
PDB Compounds: (C:) Guanylate kinase

SCOPe Domain Sequences for d2ancc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ancc1 c.37.1.1 (C:3-206) Guanylate kinase {Escherichia coli [TaxId: 562]}
qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
iraerlrmsrqkqrhdalisklla

SCOPe Domain Coordinates for d2ancc1:

Click to download the PDB-style file with coordinates for d2ancc1.
(The format of our PDB-style files is described here.)

Timeline for d2ancc1: