SCOPe 2.07: Domain d2ancb1: 2anc B:3-205

Lineage for d2ancb1 (2anc B:3-205)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase [52542] (5 species)

7. Species Escherichia coli [TaxId:562] [102338] (6 PDB entries)

8. Domain d2ancb1: 2anc B:3-205 [127041]
   automatically matched to d1s96a_

Details for d2ancb1

PDB Entry: 2anc, 3.2 Å

PDB Description: Crystal Structure Of Unliganded Form Of Oligomeric E.coli Guanylate Kinase

PDB Compounds: (B:) Guanylate kinase

SCOPe Domain Sequences for d2ancb1:

Sequence; same for both SEQRES and ATOM records:

>d2ancb1 c.37.1.1 (B:3-205) Guanylate kinase {Escherichia coli [TaxId: 562]}
qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
iraerlrmsrqkqrhdaliskll

Timeline for d2ancb1:

• d2ancb1 first appeared in SCOP 1.73
  
• d2ancb1 appears in SCOPe 2.06
  
• d2ancb1 appears in the current release, SCOPe 2.08