Lineage for d2anba_ (2anb A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123583Protein Guanylate kinase [52542] (5 species)
  7. 2123599Species Escherichia coli [TaxId:562] [102338] (6 PDB entries)
  8. 2123606Domain d2anba_: 2anb A: [127039]
    automated match to d1s96a_
    complexed with 5gp, so4

Details for d2anba_

PDB Entry: 2anb (more details), 2.9 Å

PDB Description: Crystal Structure Of Oligomeric E.coli Guanylate Kinase In Complex With GMP
PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d2anba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2anba_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}
aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
iiraerlrmsrqkqrhdaliskllad

SCOPe Domain Coordinates for d2anba_:

Click to download the PDB-style file with coordinates for d2anba_.
(The format of our PDB-style files is described here.)

Timeline for d2anba_: