Class b: All beta proteins [48724] (165 folds) |
Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (2 families) has a circularly permuted immunoglobulin-fold topology with extra strand |
Family b.8.1.2: SIAH, seven in absentia homolog [69198] (1 protein) |
Protein SIAH, seven in absentia homolog [69199] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [69200] (2 PDB entries) |
Domain d2an6d1: 2an6 D:93-282 [127036] automatically matched to d1k2fa_ complexed with zn |
PDB Entry: 2an6 (more details), 3 Å
SCOP Domain Sequences for d2an6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2an6d1 b.8.1.2 (D:93-282) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} svlfpckyassgceitlphtekaeheelcefrpyscpcpgasckwqgsldavmphlmhqh ksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivqli gtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengn lginvtismc
Timeline for d2an6d1: