![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.8.1: TRAF domain-like [49599] (3 families) ![]() has a circularly permuted immunoglobulin-fold topology with extra strand |
![]() | Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins) automatically mapped to Pfam PF03145 |
![]() | Protein SIAH, seven in absentia homolog [69199] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [69200] (2 PDB entries) |
![]() | Domain d2an6a1: 2an6 A:93-282 [127033] automatically matched to d1k2fa_ complexed with zn |
PDB Entry: 2an6 (more details), 3 Å
SCOPe Domain Sequences for d2an6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2an6a1 b.8.1.2 (A:93-282) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} svlfpckyassgceitlphtekaeheelcefrpyscpcpgasckwqgsldavmphlmhqh ksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivqli gtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengn lginvtismc
Timeline for d2an6a1: