Lineage for d2an6a1 (2an6 A:93-282)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773292Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773293Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2773395Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins)
    automatically mapped to Pfam PF03145
  6. 2773396Protein SIAH, seven in absentia homolog [69199] (1 species)
  7. 2773397Species Mouse (Mus musculus) [TaxId:10090] [69200] (2 PDB entries)
  8. 2773400Domain d2an6a1: 2an6 A:93-282 [127033]
    automatically matched to d1k2fa_
    complexed with zn

Details for d2an6a1

PDB Entry: 2an6 (more details), 3 Å

PDB Description: Protein-peptide complex
PDB Compounds: (A:) Ubiquitin ligase SIAH1A

SCOPe Domain Sequences for d2an6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2an6a1 b.8.1.2 (A:93-282) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]}
svlfpckyassgceitlphtekaeheelcefrpyscpcpgasckwqgsldavmphlmhqh
ksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivqli
gtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengn
lginvtismc

SCOPe Domain Coordinates for d2an6a1:

Click to download the PDB-style file with coordinates for d2an6a1.
(The format of our PDB-style files is described here.)

Timeline for d2an6a1: