![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins) automatically mapped to Pfam PF01234 |
![]() | Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69549] (8 PDB entries) |
![]() | Domain d2an5a_: 2an5 A: [127031] Other proteins in same PDB: d2an5b3 automated match to d1hnnb_ complexed with po4, sah, ttl |
PDB Entry: 2an5 (more details), 2.5 Å
SCOPe Domain Sequences for d2an5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2an5a_ c.66.1.15 (A:) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} vasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgp tvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqd kerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhit tllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahl qtgvddvkgvffawaqkv
Timeline for d2an5a_: