Lineage for d2an5a_ (2an5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893229Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
    automatically mapped to Pfam PF01234
  6. 2893233Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species)
  7. 2893234Species Human (Homo sapiens) [TaxId:9606] [69549] (8 PDB entries)
  8. 2893241Domain d2an5a_: 2an5 A: [127031]
    Other proteins in same PDB: d2an5b3
    automated match to d1hnnb_
    complexed with po4, sah, ttl

Details for d2an5a_

PDB Entry: 2an5 (more details), 2.5 Å

PDB Description: Structure of human PNMT complexed with S-adenosyl-homocysteine and an inhibitor, trans-(1S,2S)-2-amino-1-tetralol
PDB Compounds: (A:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d2an5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2an5a_ c.66.1.15 (A:) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}
vasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgp
tvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqd
kerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhit
tllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahl
qtgvddvkgvffawaqkv

SCOPe Domain Coordinates for d2an5a_:

Click to download the PDB-style file with coordinates for d2an5a_.
(The format of our PDB-style files is described here.)

Timeline for d2an5a_: