Lineage for d2amya1 (2amy A:4-246)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2148975Family c.108.1.10: Predicted hydrolases Cof [82388] (12 protein domains)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2149003Protein Phosphomannomutase 2 [142159] (1 species)
  7. 2149004Species Human (Homo sapiens) [TaxId:9606] [142160] (2 PDB entries)
    Uniprot O15305 4-246
  8. 2149005Domain d2amya1: 2amy A:4-246 [127026]
    complexed with edo, gly

Details for d2amya1

PDB Entry: 2amy (more details), 2.09 Å

PDB Description: x-ray structure of human phosphomannomutase 2 (pmm2)
PDB Compounds: (A:) Phosphomannomutase 2

SCOPe Domain Sequences for d2amya1:

Sequence, based on SEQRES records: (download)

>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]}
pgpalclfdvdgtltaprqkitkemddflqklrqkikigvvggsdfekvqeqlgndvvek
ydyvfpenglvaykdgkllcrqniqshlgealiqdlinyclsyiakiklpkkrgtfiefr
ngmlnvspigrscsqeeriefyeldkkenirqkfvadlrkefagkgltfsiggqisfdvf
pdgwdkryclrhvendgyktiyffgdktmpggndheiftdprtmgysvtapedtrricel
lfs

Sequence, based on observed residues (ATOM records): (download)

>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]}
pgpalclfdvdgtltaprqkitkemddflqklrqkikigvvggsdfekvqeqlgndvvek
ydyvfpenglvaykdgkllcrqniqshlgealiqdlinyclsyiakiklpkkrgtfiefr
ngmlnvspigrscsqeeriefyeldkkenirqkfvadlrkefagkgltfsiggqisfdvf
pdgwdkryclrhvendgyktiyffgdktmndheiftdprtmgysvtapedtrricellfs

SCOPe Domain Coordinates for d2amya1:

Click to download the PDB-style file with coordinates for d2amya1.
(The format of our PDB-style files is described here.)

Timeline for d2amya1: