![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins) |
![]() | Protein automated matches [190078] (5 species) not a true protein |
![]() | Species Plasmodium yoelii [TaxId:5861] [187410] (1 PDB entry) |
![]() | Domain d2amxb2: 2amx B:20-376 [127025] Other proteins in same PDB: d2amxa1, d2amxa2, d2amxb3 automated match to d2amxa1 complexed with co, unx |
PDB Entry: 2amx (more details), 2.02 Å
SCOPe Domain Sequences for d2amxb2:
Sequence, based on SEQRES records: (download)
>d2amxb2 c.1.9.1 (B:20-376) automated matches {Plasmodium yoelii [TaxId: 5861]} eikflkkedvqnidlngmskkeryeiwrripkvelhchldltfsaefflkwarkynlqpn msddeildhylftkegkslaefirkaisvsdlyrdydfiedlakwaviekykegvvlmef rysptfvsssygldvelihkafikgiknatellnnkihvalicisdtghaaasikhsgdf aikhkhdfvgfdhggreidlkdhkdvyhsvrdhglhltvhagedatlpnlntlytainil nverighgirvsesdelielvkkkdillevcpisnlllnnvksmdthpirklydagvkvs vnsddpgmflsnindnyeklyihlnftleefmimnnwafeksfvsddvkselkalyf
>d2amxb2 c.1.9.1 (B:20-376) automated matches {Plasmodium yoelii [TaxId: 5861]} eikflkkedvqnidlngmskkeryeiwrripkvelhchldltfsaefflkwarkynlqpn msddeildhylftkegkslaefirkaisvsdlyrdydfiedlakwaviekykegvvlmef rysptfvsssygldvelihkafikgiknatellnnkihvalicisdkhsgdfaikhkhdf vgfdhggreidlkdhkdvyhsvrdhglhltvhagedatlpnlntlytainilnverighg irvsesdelielvkkkdillevcpisnlllnnvksmdthpirklydagvkvsvnsddpgm flsnindnyeklyihlnftleefmimnnwafeksfvsddvkselkalyf
Timeline for d2amxb2: