Lineage for d2amxb2 (2amx B:20-376)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084339Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 protein domains)
  6. 2084387Protein automated matches [190078] (4 species)
    not a true protein
  7. 2084401Species Plasmodium yoelii [TaxId:5861] [187410] (1 PDB entry)
  8. 2084402Domain d2amxb2: 2amx B:20-376 [127025]
    Other proteins in same PDB: d2amxa1, d2amxa2, d2amxb3
    automated match to d2amxa1
    complexed with co, unx

Details for d2amxb2

PDB Entry: 2amx (more details), 2.02 Å

PDB Description: Crystal structure of Plasmodium Yoelii Adenosine deaminase (PY02076)
PDB Compounds: (B:) adenosine deaminase

SCOPe Domain Sequences for d2amxb2:

Sequence, based on SEQRES records: (download)

>d2amxb2 c.1.9.1 (B:20-376) automated matches {Plasmodium yoelii [TaxId: 5861]}
eikflkkedvqnidlngmskkeryeiwrripkvelhchldltfsaefflkwarkynlqpn
msddeildhylftkegkslaefirkaisvsdlyrdydfiedlakwaviekykegvvlmef
rysptfvsssygldvelihkafikgiknatellnnkihvalicisdtghaaasikhsgdf
aikhkhdfvgfdhggreidlkdhkdvyhsvrdhglhltvhagedatlpnlntlytainil
nverighgirvsesdelielvkkkdillevcpisnlllnnvksmdthpirklydagvkvs
vnsddpgmflsnindnyeklyihlnftleefmimnnwafeksfvsddvkselkalyf

Sequence, based on observed residues (ATOM records): (download)

>d2amxb2 c.1.9.1 (B:20-376) automated matches {Plasmodium yoelii [TaxId: 5861]}
eikflkkedvqnidlngmskkeryeiwrripkvelhchldltfsaefflkwarkynlqpn
msddeildhylftkegkslaefirkaisvsdlyrdydfiedlakwaviekykegvvlmef
rysptfvsssygldvelihkafikgiknatellnnkihvalicisdkhsgdfaikhkhdf
vgfdhggreidlkdhkdvyhsvrdhglhltvhagedatlpnlntlytainilnverighg
irvsesdelielvkkkdillevcpisnlllnnvksmdthpirklydagvkvsvnsddpgm
flsnindnyeklyihlnftleefmimnnwafeksfvsddvkselkalyf

SCOPe Domain Coordinates for d2amxb2:

Click to download the PDB-style file with coordinates for d2amxb2.
(The format of our PDB-style files is described here.)

Timeline for d2amxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2amxb3