SCOPe 2.08: Domain d2amsa_: 2ams A:

Lineage for d2amsa_ (2ams A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
   folds around 4Fe-4S cluster

4. Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family)

5. Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)

6. Protein HIPIP (high potential iron protein) [57654] (9 species)

7. Species Allochromatium vinosum [TaxId:1049] [186948] (1 PDB entry)

8. Domain d2amsa_: 2ams A: [127023]
   automated match to d1eyta_
   complexed with gol, sf4, so4

Details for d2amsa_

PDB Entry: 2ams, 1.4 Å

PDB Description: structure of the oxidized hipip from thermochromatium tepidum at 1.4 angstrom resolution

PDB Compounds: (A:) High potential iron-sulfur protein

SCOPe Domain Sequences for d2amsa_:

Sequence; same for both SEQRES and ATOM records:

>d2amsa_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Allochromatium vinosum [TaxId: 1049]}
aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
cqlfpgklinvngwcaswtlkag

Timeline for d2amsa_:

• d2amsa_ first appeared in SCOP 1.73, called d2amsa1
  
• d2amsa_ appears in SCOPe 2.07