SCOPe 2.07: Domain d2ampb_: 2amp B:

Lineage for d2ampb_ (2amp B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
   contains an extra alpha-helical domain

7. Species Transmissible gastroenteritis virus [TaxId:11149] [74980] (3 PDB entries)

8. Domain d2ampb_: 2amp B: [127022]
   automated match to d1lvod_
   complexed with i12

Details for d2ampb_

PDB Entry: 2amp, 2.7 Å

PDB Description: Crystal Structure Of Porcine Transmissible Gastroenteritis Virus Mpro in Complex with an Inhibitor N1

PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d2ampb_:

Sequence; same for both SEQRES and ATOM records:

>d2ampb_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Transmissible gastroenteritis virus [TaxId: 11149]}
sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv
rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc
pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem
yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte
lsstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmygv

Timeline for d2ampb_:

• d2ampb_ first appeared in SCOP 1.73, called d2ampb1
  
• d2ampb_ appears in SCOPe 2.06
  
• d2ampb_ appears in the current release, SCOPe 2.08