SCOP 1.73: Domain d2ampb1: 2amp B:1-299

Lineage for d2ampb1 (2amp B:1-299)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species)
   contains an extra alpha-helical domain

7. Species Transmissible gastroenteritis virus [TaxId:11149] [74980] (3 PDB entries)

8. Domain d2ampb1: 2amp B:1-299 [127022]
   automatically matched to d1lvod_
   complexed with i12

Details for d2ampb1

PDB Entry: 2amp, 2.7 Å

PDB Description: Crystal Structure Of Porcine Transmissible Gastroenteritis Virus Mpro in Complex with an Inhibitor N1

PDB Compounds: (B:) 3C-like proteinase

SCOP Domain Sequences for d2ampb1:

Sequence; same for both SEQRES and ATOM records:

>d2ampb1 b.47.1.4 (B:1-299) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Transmissible gastroenteritis virus [TaxId: 11149]}
sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv
rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc
pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem
yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte
lsstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmygv

Timeline for d2ampb1:

• d2ampb1 is new in SCOP 1.73
  
• d2ampb1 appears in SCOP 1.75
  
• d2ampb1 appears in the current release, SCOPe 2.08, called d2ampb_