Lineage for d2amha1 (2amh A:7-207)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120781Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2120998Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2121030Family c.51.4.2: Maf-like [52976] (3 protein domains)
    automatically mapped to Pfam PF02545
  6. 2121031Protein Maf homologue Tb11.01.5890 [142428] (1 species)
  7. 2121032Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [142429] (1 PDB entry)
    Uniprot Q382A9 3-203
  8. 2121033Domain d2amha1: 2amh A:7-207 [127019]
    complexed with mn, so4

Details for d2amha1

PDB Entry: 2amh (more details), 2 Å

PDB Description: crystal structure of maf-like protein tbru21784aaa from t.brucei
PDB Compounds: (A:) septum formation protein MAF homologue, putative

SCOPe Domain Sequences for d2amha1:

Sequence, based on SEQRES records: (download)

>d2amha1 c.51.4.2 (A:7-207) Maf homologue Tb11.01.5890 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
eeirtmiigtssafranvlrehfgdrfrnfvllppdidekayraadpfeltesiarakmk
avlekarqhsppisgpaialtfdqvvvkgdevrekplsteqcrsfiasysgggvrtvaty
alcvvgtenvlvahnetetffskfgddivertlergacmnsagglvvededmsrhvvriv
gtsygvrgmepavvekllsql

Sequence, based on observed residues (ATOM records): (download)

>d2amha1 c.51.4.2 (A:7-207) Maf homologue Tb11.01.5890 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
eeirtmiigtssafranvlrehfgdrfrnfvllppdidekayraadpfeltesiarakmk
avlekarqhpaialtfdqvvvkgdevrekplsteqcrsfiasysgggvrtvatyalcvvg
tenvlvahnetetffskfgddivertlergacmnsagglvvededmsrhvvrivgtsygv
rgmepavvekllsql

SCOPe Domain Coordinates for d2amha1:

Click to download the PDB-style file with coordinates for d2amha1.
(The format of our PDB-style files is described here.)

Timeline for d2amha1: