![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins) similar dimer to the class I KARI |
![]() | Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [140776] (2 PDB entries) Uniprot Q9A1S9 153-256 |
![]() | Domain d2amfe1: 2amf E:153-256 [127017] Other proteins in same PDB: d2amfa2, d2amfb2, d2amfc2, d2amfd2, d2amfe2 automated match to d2ahra1 complexed with na, pro |
PDB Entry: 2amf (more details), 2.2 Å
SCOPe Domain Sequences for d2amfe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2amfe1 a.100.1.10 (E:153-256) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} kdfdtftalagsspayiylfiealakagvkngipkakaleivtqtvlasasnlktssqsp hdfidaicspggttiaglmelerlgltatvssaidktidkaksl
Timeline for d2amfe1: