SCOPe 2.04: Domain d2amfd1: 2amf D:153-256

Lineage for d2amfd1 (2amf D:153-256)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins)
   similar dimer to the class I KARI

6. Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species)

7. Species Streptococcus pyogenes [TaxId:1314] [140776] (2 PDB entries)
   Uniprot Q9A1S9 153-256

8. Domain d2amfd1: 2amf D:153-256 [127015]
   Other proteins in same PDB: d2amfa2, d2amfb2, d2amfc2, d2amfd2, d2amfe2
   automated match to d2ahra1
   complexed with na, pro

Details for d2amfd1

PDB Entry: 2amf, 2.2 Å

PDB Description: crystal structure of 1-pyrroline-5-carboxylate reductase from human pathogen streptococcus pyogenes

PDB Compounds: (D:) 1-Pyrroline-5-Carboxylate reductase

SCOPe Domain Sequences for d2amfd1:

Sequence; same for both SEQRES and ATOM records:

>d2amfd1 a.100.1.10 (D:153-256) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]}
kdfdtftalagsspayiylfiealakagvkngipkakaleivtqtvlasasnlktssqsp
hdfidaicspggttiaglmelerlgltatvssaidktidkaksl

Timeline for d2amfd1:

• d2amfd1 first appeared in SCOP 1.73
  
• d2amfd1 appears in SCOPe 2.03
  
• d2amfd1 appears in SCOPe 2.05
  
• d2amfd1 appears in the current release, SCOPe 2.08