![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
![]() | Protein Pyrroline-5-carboxylate reductase ProC [117434] (2 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [141928] (2 PDB entries) Uniprot Q9A1S9 1-152 |
![]() | Domain d2amfc2: 2amf C:1-152 [127014] Other proteins in same PDB: d2amfa1, d2amfb1, d2amfc1, d2amfd1, d2amfe1 automated match to d2ahra2 complexed with na, pro |
PDB Entry: 2amf (more details), 2.2 Å
SCOPe Domain Sequences for d2amfc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2amfc2 c.2.1.6 (C:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} mkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidqvdl vilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqilqss taltgnalvsqelqarvrdltdsfgstfdise
Timeline for d2amfc2: