SCOP 1.75: Domain d2amfc2: 2amf C:1-152

Lineage for d2amfc2 (2amf C:1-152)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Pyrroline-5-carboxylate reductase ProC [117434] (2 species)

7. Species Streptococcus pyogenes [TaxId:1314] [141928] (2 PDB entries)
   Uniprot Q9A1S9 1-152

8. Domain d2amfc2: 2amf C:1-152 [127014]
   Other proteins in same PDB: d2amfa1, d2amfb1, d2amfc1, d2amfd1, d2amfe1
   automatically matched to 2AHR A:1-152
   complexed with na, pro

Details for d2amfc2

PDB Entry: 2amf, 2.2 Å

PDB Description: crystal structure of 1-pyrroline-5-carboxylate reductase from human pathogen streptococcus pyogenes

PDB Compounds: (C:) 1-Pyrroline-5-Carboxylate reductase

SCOP Domain Sequences for d2amfc2:

Sequence; same for both SEQRES and ATOM records:

>d2amfc2 c.2.1.6 (C:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]}
mkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidqvdl
vilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqilqss
taltgnalvsqelqarvrdltdsfgstfdise

Timeline for d2amfc2:

• d2amfc2 first appeared in SCOP 1.73
  
• d2amfc2 appears in SCOPe 2.01
  
• d2amfc2 appears in the current release, SCOPe 2.08