Lineage for d2amfb2 (2amf B:1-152)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844998Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2845130Protein Pyrroline-5-carboxylate reductase ProC [117434] (2 species)
  7. 2845135Species Streptococcus pyogenes [TaxId:1314] [141928] (2 PDB entries)
    Uniprot Q9A1S9 1-152
  8. 2845142Domain d2amfb2: 2amf B:1-152 [127012]
    Other proteins in same PDB: d2amfa1, d2amfa3, d2amfb1, d2amfb3, d2amfc1, d2amfd1, d2amfd3, d2amfe1, d2amfe3
    automated match to d2ahra2
    complexed with na, pro

Details for d2amfb2

PDB Entry: 2amf (more details), 2.2 Å

PDB Description: crystal structure of 1-pyrroline-5-carboxylate reductase from human pathogen streptococcus pyogenes
PDB Compounds: (B:) 1-Pyrroline-5-Carboxylate reductase

SCOPe Domain Sequences for d2amfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2amfb2 c.2.1.6 (B:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]}
mkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidqvdl
vilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqilqss
taltgnalvsqelqarvrdltdsfgstfdise

SCOPe Domain Coordinates for d2amfb2:

Click to download the PDB-style file with coordinates for d2amfb2.
(The format of our PDB-style files is described here.)

Timeline for d2amfb2: