Class a: All alpha proteins [46456] (284 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins) similar dimer to the class I KARI |
Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species) |
Species Streptococcus pyogenes [TaxId:1314] [140776] (2 PDB entries) Uniprot Q9A1S9 153-256 |
Domain d2amfb1: 2amf B:153-256 [127011] Other proteins in same PDB: d2amfa2, d2amfb2, d2amfc2, d2amfd2, d2amfe2 automatically matched to 2AHR A:153-256 complexed with na, pro |
PDB Entry: 2amf (more details), 2.2 Å
SCOP Domain Sequences for d2amfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2amfb1 a.100.1.10 (B:153-256) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} kdfdtftalagsspayiylfiealakagvkngipkakaleivtqtvlasasnlktssqsp hdfidaicspggttiaglmelerlgltatvssaidktidkaksl
Timeline for d2amfb1: