Lineage for d2amfb1 (2amf B:153-256)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins)
    similar dimer to the class I KARI
  6. Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species)
  7. Species Streptococcus pyogenes [TaxId:1314] [140776] (2 PDB entries)
    Uniprot Q9A1S9 153-256
  8. Domain d2amfb1: 2amf B:153-256 [127011]
    Other proteins in same PDB: d2amfa2, d2amfa3, d2amfb2, d2amfb3, d2amfc2, d2amfd2, d2amfd3, d2amfe2, d2amfe3
    automated match to d2ahra1
    complexed with na, pro

Details for d2amfb1

PDB Entry: 2amf (more details), 2.2 Å

PDB Description: crystal structure of 1-pyrroline-5-carboxylate reductase from human pathogen streptococcus pyogenes
PDB Compounds: (B:) 1-Pyrroline-5-Carboxylate reductase

SCOPe Domain Sequences for d2amfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2amfb1 a.100.1.10 (B:153-256) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]}
kdfdtftalagsspayiylfiealakagvkngipkakaleivtqtvlasasnlktssqsp
hdfidaicspggttiaglmelerlgltatvssaidktidkaksl

SCOPe Domain Coordinates for d2amfb1 are not available.

Timeline for d2amfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2amfb2, d2amfb3
View in 3D
Domains from other chains:
(mouse over for more information)
d2amfa1, d2amfa2, d2amfa3, d2amfc1, d2amfc2, d2amfd1, d2amfd2, d2amfd3, d2amfe1, d2amfe2, d2amfe3