Lineage for d2amfa1 (2amf A:153-256)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742411Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1742412Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1742574Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins)
    similar dimer to the class I KARI
  6. 1742578Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species)
  7. 1742582Species Streptococcus pyogenes [TaxId:1314] [140776] (2 PDB entries)
    Uniprot Q9A1S9 153-256
  8. 1742588Domain d2amfa1: 2amf A:153-256 [127009]
    Other proteins in same PDB: d2amfa2, d2amfb2, d2amfc2, d2amfd2, d2amfe2
    automated match to d2ahra1
    complexed with na, pro

Details for d2amfa1

PDB Entry: 2amf (more details), 2.2 Å

PDB Description: crystal structure of 1-pyrroline-5-carboxylate reductase from human pathogen streptococcus pyogenes
PDB Compounds: (A:) 1-Pyrroline-5-Carboxylate reductase

SCOPe Domain Sequences for d2amfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2amfa1 a.100.1.10 (A:153-256) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]}
kdfdtftalagsspayiylfiealakagvkngipkakaleivtqtvlasasnlktssqsp
hdfidaicspggttiaglmelerlgltatvssaidktidkaksl

SCOPe Domain Coordinates for d2amfa1:

Click to download the PDB-style file with coordinates for d2amfa1.
(The format of our PDB-style files is described here.)

Timeline for d2amfa1: